PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.277570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 203aa    MW: 23335 Da    PI: 8.2002
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.277570.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.8e-17550348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT+eEd ll+++++q+G g W+++++  g++R++k+c++rw++yl
   Cucsa.277570.1  5 AWTEEEDYLLKKCIEQYGEGKWHRVPQLAGLNRCRKSCRLRWLNYL 50
                     6*******************************************97 PP

2Myb_DNA-binding47.93e-1556100147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T++E +l++++++ lG++ W+ Ia +++ gRt++++k++w+ +
   Cucsa.277570.1  56 RGSFTPQEVDLILNLHNILGNR-WSIIAGRLP-GRTANDIKNYWNCH 100
                      89********************.*********.***********977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.426150IPR017930Myb domain
SMARTSM007173.1E-13252IPR001005SANT/Myb domain
PfamPF002491.5E-15550IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-22557IPR009057Homeodomain-like
SuperFamilySSF466891.17E-28597IPR009057Homeodomain-like
CDDcd001671.75E-11550No hitNo description
PROSITE profilePS5129423.85151105IPR017930Myb domain
SMARTSM007178.0E-1555103IPR001005SANT/Myb domain
PfamPF002491.5E-135698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2458105IPR009057Homeodomain-like
CDDcd001674.74E-1058101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MGGIAWTEEE DYLLKKCIEQ YGEGKWHRVP QLAGLNRCRK SCRLRWLNYL RPNIKRGSFT  60
PQEVDLILNL HNILGNRWSI IAGRLPGRTA NDIKNYWNCH LSKKLNGQGV EKPNSTKEGS  120
NFGKQSKWKP LQEESSKSKG KEYVDDDQNN ESQGILVQNN QNQNTQPIVV EQNSSMSLGN  180
MQMDLFQFDQ QVLKAMEDED GCX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-22610610109B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00213DAPTransfer from AT1G66370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818461e-148LN681846.1 Cucumis melo genomic scaffold, anchoredscaffold00009.
GenBankLN7132591e-148LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004138976.11e-149PREDICTED: transcription factor MYB1-like
TrEMBLA0A142D8G11e-68A0A142D8G1_9CARY; Myb transcription factor 5 (Fragment)
TrEMBLA0A061F2611e-68A0A061F261_THECC; Myb domain protein 113, putative
STRINGGLYMA07G16980.19e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.11e-55myb domain protein 113